Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,529
  2. Avatar for xkcd 12. xkcd 2 pts. 8,516
  3. Avatar for Deleted group 13. Deleted group pts. 8,500
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,309
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 7,768
  6. Avatar for LCC Organic Chemistry 16. LCC Organic Chemistry 1 pt. 6,922
  7. Avatar for freefolder 17. freefolder 1 pt. 6,450
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 6,258
  9. Avatar for TheBirds 19. TheBirds 1 pt. 4,645
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 4,621

  1. Avatar for poiuyqwert 121. poiuyqwert Lv 1 1 pt. 7,796
  2. Avatar for Zephtar 122. Zephtar Lv 1 1 pt. 7,788
  3. Avatar for jarbolol15 123. jarbolol15 Lv 1 1 pt. 7,786
  4. Avatar for guineapig 124. guineapig Lv 1 1 pt. 7,783
  5. Avatar for kitek314_pl 125. kitek314_pl Lv 1 1 pt. 7,768
  6. Avatar for DScott 126. DScott Lv 1 1 pt. 7,747
  7. Avatar for karost 127. karost Lv 1 1 pt. 7,740
  8. Avatar for tela 128. tela Lv 1 1 pt. 7,735
  9. Avatar for senor pit 129. senor pit Lv 1 1 pt. 7,723
  10. Avatar for Graham MF 130. Graham MF Lv 1 1 pt. 7,709

Comments