Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,529
  2. Avatar for xkcd 12. xkcd 2 pts. 8,516
  3. Avatar for Deleted group 13. Deleted group pts. 8,500
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,309
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 7,768
  6. Avatar for LCC Organic Chemistry 16. LCC Organic Chemistry 1 pt. 6,922
  7. Avatar for freefolder 17. freefolder 1 pt. 6,450
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 6,258
  9. Avatar for TheBirds 19. TheBirds 1 pt. 4,645
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 4,621

  1. Avatar for Tac1 151. Tac1 Lv 1 1 pt. 6,841
  2. Avatar for Cerzax 152. Cerzax Lv 1 1 pt. 6,817
  3. Avatar for VoltaicRainbow 153. VoltaicRainbow Lv 1 1 pt. 6,652
  4. Avatar for lamoille 155. lamoille Lv 1 1 pt. 6,464
  5. Avatar for Altercomp 156. Altercomp Lv 1 1 pt. 6,450
  6. Avatar for khendarg 157. khendarg Lv 1 1 pt. 6,298
  7. Avatar for Tlaloc 158. Tlaloc Lv 1 1 pt. 6,258
  8. Avatar for mirjamvandelft 159. mirjamvandelft Lv 1 1 pt. 6,015
  9. Avatar for lacie 160. lacie Lv 1 1 pt. 6,009

Comments