Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,529
  2. Avatar for xkcd 12. xkcd 2 pts. 8,516
  3. Avatar for Deleted group 13. Deleted group pts. 8,500
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,309
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 7,768
  6. Avatar for LCC Organic Chemistry 16. LCC Organic Chemistry 1 pt. 6,922
  7. Avatar for freefolder 17. freefolder 1 pt. 6,450
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 6,258
  9. Avatar for TheBirds 19. TheBirds 1 pt. 4,645
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 4,621
  1. Avatar for fishercat 51. fishercat Lv 1 23 pts. 8,609
  2. Avatar for phi16 52. phi16 Lv 1 22 pts. 8,601
  3. Avatar for joremen 53. joremen Lv 1 21 pts. 8,590
  4. Avatar for smholst 54. smholst Lv 1 20 pts. 8,585
  5. Avatar for pvc78 55. pvc78 Lv 1 20 pts. 8,580
  6. Avatar for snakeguy 56. snakeguy Lv 1 19 pts. 8,571
  7. Avatar for DodoBird 57. DodoBird Lv 1 18 pts. 8,571
  8. Avatar for Vinara 58. Vinara Lv 1 18 pts. 8,560
  9. Avatar for jobo0502 59. jobo0502 Lv 1 17 pts. 8,556
  10. Avatar for BCAA 60. BCAA Lv 1 16 pts. 8,545

Comments