Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,529
  2. Avatar for xkcd 12. xkcd 2 pts. 8,516
  3. Avatar for Deleted group 13. Deleted group pts. 8,500
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 8,309
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 7,768
  6. Avatar for LCC Organic Chemistry 16. LCC Organic Chemistry 1 pt. 6,922
  7. Avatar for freefolder 17. freefolder 1 pt. 6,450
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 6,258
  9. Avatar for TheBirds 19. TheBirds 1 pt. 4,645
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 4,621
  1. Avatar for heather-1 81. heather-1 Lv 1 7 pts. 8,329
  2. Avatar for egran48 82. egran48 Lv 1 7 pts. 8,319
  3. Avatar for aendgraend 83. aendgraend Lv 1 7 pts. 8,309
  4. Avatar for YeshuaLives 84. YeshuaLives Lv 1 6 pts. 8,293
  5. Avatar for moep 85. moep Lv 1 6 pts. 8,276
  6. Avatar for manu8170 86. manu8170 Lv 1 6 pts. 8,270
  7. Avatar for uihcv 87. uihcv Lv 1 6 pts. 8,231
  8. Avatar for SKSbell 88. SKSbell Lv 1 5 pts. 8,225
  9. Avatar for Squirrely 89. Squirrely Lv 1 5 pts. 8,219
  10. Avatar for RestrictionEndoNykolease 90. RestrictionEndoNykolease Lv 1 5 pts. 8,211

Comments