Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,106
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,095
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 9,028
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,022
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 31 pts. 8,886
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 8,885
  7. Avatar for Go Science 7. Go Science 15 pts. 8,874
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 8,858
  9. Avatar for Deleted group 9. Deleted group pts. 8,749
  10. Avatar for It's over 9000! 10. It's over 9000! 5 pts. 8,545
  1. Avatar for phi16 21. phi16 Lv 1 2 pts. 9,001
  2. Avatar for Mark- 22. Mark- Lv 1 2 pts. 8,995
  3. Avatar for alcor29 23. alcor29 Lv 1 1 pt. 8,970
  4. Avatar for dbuske 24. dbuske Lv 1 1 pt. 8,927
  5. Avatar for mimi 25. mimi Lv 1 1 pt. 8,925
  6. Avatar for martin.szew 26. martin.szew Lv 1 1 pt. 8,910
  7. Avatar for Paulo Roque 27. Paulo Roque Lv 1 1 pt. 8,874
  8. Avatar for jeff101 28. jeff101 Lv 1 1 pt. 8,874
  9. Avatar for Bruno Kestemont 29. Bruno Kestemont Lv 1 1 pt. 8,873
  10. Avatar for DodoBird 30. DodoBird Lv 1 1 pt. 8,864

Comments