Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for Contenders 100 pts. 9,106
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,095
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 9,028
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,022
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 31 pts. 8,886
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 8,885
  7. Avatar for Go Science 7. Go Science 15 pts. 8,874
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 8,858
  9. Avatar for Deleted group 9. Deleted group pts. 8,749
  10. Avatar for It's over 9000! 10. It's over 9000! 5 pts. 8,545

  1. Avatar for fiendish_ghoul 21. fiendish_ghoul Lv 1 58 pts. 8,841
  2. Avatar for g_b 22. g_b Lv 1 57 pts. 8,839
  3. Avatar for nicobul 23. nicobul Lv 1 55 pts. 8,834
  4. Avatar for Mike Cassidy 24. Mike Cassidy Lv 1 53 pts. 8,829
  5. Avatar for Deleted player 25. Deleted player pts. 8,827
  6. Avatar for pauldunn 26. pauldunn Lv 1 50 pts. 8,826
  7. Avatar for Bruno Kestemont 27. Bruno Kestemont Lv 1 49 pts. 8,818
  8. Avatar for reefyrob 28. reefyrob Lv 1 47 pts. 8,804
  9. Avatar for WarpSpeed 29. WarpSpeed Lv 1 46 pts. 8,793
  10. Avatar for hansvandenhof 30. hansvandenhof Lv 1 45 pts. 8,789

Comments