Placeholder image of a protein
Icon representing a puzzle

1237: Unsolved De-novo Freestyle 80

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
May 23, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for Contenders 100 pts. 9,106
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,095
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 9,028
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 43 pts. 9,022
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 31 pts. 8,886
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 8,885
  7. Avatar for Go Science 7. Go Science 15 pts. 8,874
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 8,858
  9. Avatar for Deleted group 9. Deleted group pts. 8,749
  10. Avatar for It's over 9000! 10. It's over 9000! 5 pts. 8,545

  1. Avatar for yhevalet 181. yhevalet Lv 1 1 pt. 0
  2. Avatar for Paulo Roque 182. Paulo Roque Lv 1 1 pt. 0
  3. Avatar for dettingen 183. dettingen Lv 1 1 pt. 0
  4. Avatar for Astronoma 184. Astronoma Lv 1 1 pt. 0
  5. Avatar for aminal 185. aminal Lv 1 1 pt. 0
  6. Avatar for heyubob 186. heyubob Lv 1 1 pt. 0
  7. Avatar for xrossy05 187. xrossy05 Lv 1 1 pt. 0
  8. Avatar for noforgiven 188. noforgiven Lv 1 1 pt. 0
  9. Avatar for ivalnic 189. ivalnic Lv 1 1 pt. 0
  10. Avatar for YGK 190. YGK Lv 1 1 pt. 0

Comments