Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,385
  2. Avatar for It's over 9000! 12. It's over 9000! 3 pts. 9,315
  3. Avatar for Russian team 13. Russian team 2 pts. 9,232
  4. Avatar for freefolder 14. freefolder 1 pt. 9,149
  5. Avatar for xkcd 15. xkcd 1 pt. 9,134
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,055
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 9,054
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,043
  9. Avatar for BCC 19. BCC 1 pt. 8,738
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,655
  1. Avatar for jebbiek 91. jebbiek Lv 1 5 pts. 9,206
  2. Avatar for mitarcher 92. mitarcher Lv 1 5 pts. 9,202
  3. Avatar for pandapharmd 93. pandapharmd Lv 1 5 pts. 9,170
  4. Avatar for Iron pet 94. Iron pet Lv 1 4 pts. 9,170
  5. Avatar for Superphosphate 95. Superphosphate Lv 1 4 pts. 9,166
  6. Avatar for SouperGenious 96. SouperGenious Lv 1 4 pts. 9,166
  7. Avatar for uihcv 97. uihcv Lv 1 4 pts. 9,158
  8. Avatar for Altercomp 98. Altercomp Lv 1 4 pts. 9,149
  9. Avatar for TastyMunchies 99. TastyMunchies Lv 1 3 pts. 9,147
  10. Avatar for tela 100. tela Lv 1 3 pts. 9,147

Comments