Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,385
  2. Avatar for It's over 9000! 12. It's over 9000! 3 pts. 9,315
  3. Avatar for Russian team 13. Russian team 2 pts. 9,232
  4. Avatar for freefolder 14. freefolder 1 pt. 9,149
  5. Avatar for xkcd 15. xkcd 1 pt. 9,134
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,055
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 9,054
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,043
  9. Avatar for BCC 19. BCC 1 pt. 8,738
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,655
  1. Avatar for fryguy 101. fryguy Lv 1 3 pts. 9,134
  2. Avatar for Darkly Deadpan 102. Darkly Deadpan Lv 1 3 pts. 9,132
  3. Avatar for ppp6 103. ppp6 Lv 1 3 pts. 9,127
  4. Avatar for JUMELLE54 104. JUMELLE54 Lv 1 3 pts. 9,125
  5. Avatar for senor pit 105. senor pit Lv 1 3 pts. 9,115
  6. Avatar for phi16 106. phi16 Lv 1 3 pts. 9,113
  7. Avatar for demeter900 107. demeter900 Lv 1 2 pts. 9,111
  8. Avatar for willanth 108. willanth Lv 1 2 pts. 9,103
  9. Avatar for jobo0502 109. jobo0502 Lv 1 2 pts. 9,083
  10. Avatar for Auntecedent 110. Auntecedent Lv 1 2 pts. 9,082

Comments