Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,385
  2. Avatar for It's over 9000! 12. It's over 9000! 3 pts. 9,315
  3. Avatar for Russian team 13. Russian team 2 pts. 9,232
  4. Avatar for freefolder 14. freefolder 1 pt. 9,149
  5. Avatar for xkcd 15. xkcd 1 pt. 9,134
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,055
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 9,054
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,043
  9. Avatar for BCC 19. BCC 1 pt. 8,738
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,655
  1. Avatar for harvardman 111. harvardman Lv 1 2 pts. 9,081
  2. Avatar for leehaggis 112. leehaggis Lv 1 2 pts. 9,078
  3. Avatar for diamonddays 113. diamonddays Lv 1 2 pts. 9,064
  4. Avatar for sheerbliss 114. sheerbliss Lv 1 2 pts. 9,058
  5. Avatar for kitek314_pl 115. kitek314_pl Lv 1 2 pts. 9,055
  6. Avatar for cherry39 116. cherry39 Lv 1 2 pts. 9,054
  7. Avatar for Jajaboman 117. Jajaboman Lv 1 2 pts. 9,054
  8. Avatar for nemo7731 118. nemo7731 Lv 1 1 pt. 9,052
  9. Avatar for navn 119. navn Lv 1 1 pt. 9,051
  10. Avatar for Punktchen 120. Punktchen Lv 1 1 pt. 9,048

Comments