Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,385
  2. Avatar for It's over 9000! 12. It's over 9000! 3 pts. 9,315
  3. Avatar for Russian team 13. Russian team 2 pts. 9,232
  4. Avatar for freefolder 14. freefolder 1 pt. 9,149
  5. Avatar for xkcd 15. xkcd 1 pt. 9,134
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,055
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 9,054
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,043
  9. Avatar for BCC 19. BCC 1 pt. 8,738
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,655
  1. Avatar for Ashrai 151. Ashrai Lv 1 1 pt. 8,844
  2. Avatar for cacogen_man 152. cacogen_man Lv 1 1 pt. 8,843
  3. Avatar for yoyoparis 153. yoyoparis Lv 1 1 pt. 8,842
  4. Avatar for gurch 154. gurch Lv 1 1 pt. 8,834
  5. Avatar for IsdatoGames 155. IsdatoGames Lv 1 1 pt. 8,825
  6. Avatar for lockert 156. lockert Lv 1 1 pt. 8,824
  7. Avatar for mirjamvandelft 157. mirjamvandelft Lv 1 1 pt. 8,824
  8. Avatar for rezaefar 158. rezaefar Lv 1 1 pt. 8,818
  9. Avatar for Tac1 159. Tac1 Lv 1 1 pt. 8,802
  10. Avatar for Astronoma 160. Astronoma Lv 1 1 pt. 8,801

Comments