Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,385
  2. Avatar for It's over 9000! 12. It's over 9000! 3 pts. 9,315
  3. Avatar for Russian team 13. Russian team 2 pts. 9,232
  4. Avatar for freefolder 14. freefolder 1 pt. 9,149
  5. Avatar for xkcd 15. xkcd 1 pt. 9,134
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,055
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 9,054
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,043
  9. Avatar for BCC 19. BCC 1 pt. 8,738
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,655
  1. Avatar for emelia24 171. emelia24 Lv 1 1 pt. 8,728
  2. Avatar for Themis3000 172. Themis3000 Lv 1 1 pt. 8,721
  3. Avatar for NotJim99 173. NotJim99 Lv 1 1 pt. 8,684
  4. Avatar for Rechenkraft.net 174. Rechenkraft.net Lv 1 1 pt. 8,671
  5. Avatar for Johnnyruiz 175. Johnnyruiz Lv 1 1 pt. 8,658
  6. Avatar for Tlaloc 176. Tlaloc Lv 1 1 pt. 8,655
  7. Avatar for yhevalet 177. yhevalet Lv 1 1 pt. 8,654
  8. Avatar for HMK 178. HMK Lv 1 1 pt. 8,565
  9. Avatar for kalonfest 179. kalonfest Lv 1 1 pt. 8,448
  10. Avatar for dssb 180. dssb Lv 1 1 pt. 8,405

Comments