Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,385
  2. Avatar for It's over 9000! 12. It's over 9000! 3 pts. 9,315
  3. Avatar for Russian team 13. Russian team 2 pts. 9,232
  4. Avatar for freefolder 14. freefolder 1 pt. 9,149
  5. Avatar for xkcd 15. xkcd 1 pt. 9,134
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,055
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 9,054
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,043
  9. Avatar for BCC 19. BCC 1 pt. 8,738
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,655
  1. Avatar for Mark- 21. Mark- Lv 1 59 pts. 9,602
  2. Avatar for Scopper 22. Scopper Lv 1 57 pts. 9,596
  3. Avatar for jermainiac 23. jermainiac Lv 1 55 pts. 9,580
  4. Avatar for Bletchley Park 24. Bletchley Park Lv 1 54 pts. 9,567
  5. Avatar for pmdpmd 25. pmdpmd Lv 1 52 pts. 9,562
  6. Avatar for Bruno Kestemont 26. Bruno Kestemont Lv 1 51 pts. 9,562
  7. Avatar for Alistair69 27. Alistair69 Lv 1 49 pts. 9,557
  8. Avatar for drumpeter18yrs9yrs 28. drumpeter18yrs9yrs Lv 1 48 pts. 9,548
  9. Avatar for Museka 29. Museka Lv 1 46 pts. 9,546
  10. Avatar for dcrwheeler 30. dcrwheeler Lv 1 45 pts. 9,520

Comments