Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 9,385
  2. Avatar for It's over 9000! 12. It's over 9000! 3 pts. 9,315
  3. Avatar for Russian team 13. Russian team 2 pts. 9,232
  4. Avatar for freefolder 14. freefolder 1 pt. 9,149
  5. Avatar for xkcd 15. xkcd 1 pt. 9,134
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,055
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 9,054
  8. Avatar for SETI.Germany 18. SETI.Germany 1 pt. 9,043
  9. Avatar for BCC 19. BCC 1 pt. 8,738
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,655
  1. Avatar for ViJay7019 41. ViJay7019 Lv 1 32 pts. 9,478
  2. Avatar for Anfinsen_slept_here 42. Anfinsen_slept_here Lv 1 31 pts. 9,476
  3. Avatar for Blipperman 43. Blipperman Lv 1 30 pts. 9,466
  4. Avatar for cbwest 44. cbwest Lv 1 29 pts. 9,466
  5. Avatar for hansvandenhof 45. hansvandenhof Lv 1 28 pts. 9,464
  6. Avatar for nicobul 46. nicobul Lv 1 27 pts. 9,463
  7. Avatar for deLaCeiba 47. deLaCeiba Lv 1 26 pts. 9,453
  8. Avatar for Marvelz 48. Marvelz Lv 1 25 pts. 9,450
  9. Avatar for fiendish_ghoul 49. fiendish_ghoul Lv 1 25 pts. 9,447
  10. Avatar for g_b 50. g_b Lv 1 24 pts. 9,439

Comments