Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,990
  2. Avatar for ricg test group 22. ricg test group 1 pt. 0
  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 9,856
  2. Avatar for LociOiling 2. LociOiling Lv 1 86 pts. 9,830
  3. Avatar for reefyrob 3. reefyrob Lv 1 73 pts. 9,822
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 62 pts. 9,820
  5. Avatar for Deleted player 5. Deleted player pts. 9,787
  6. Avatar for mimi 6. mimi Lv 1 43 pts. 9,720
  7. Avatar for Scopper 7. Scopper Lv 1 36 pts. 9,702
  8. Avatar for Paulo Roque 8. Paulo Roque Lv 1 30 pts. 9,700
  9. Avatar for pauldunn 9. pauldunn Lv 1 24 pts. 9,700
  10. Avatar for egran48 10. egran48 Lv 1 20 pts. 9,696

Comments