Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,990
  2. Avatar for ricg test group 22. ricg test group 1 pt. 0
  1. Avatar for aendgraend 121. aendgraend Lv 1 1 pt. 9,043
  2. Avatar for cinnamonkitty 122. cinnamonkitty Lv 1 1 pt. 9,036
  3. Avatar for DScott 123. DScott Lv 1 1 pt. 9,034
  4. Avatar for Psych0Active 124. Psych0Active Lv 1 1 pt. 9,031
  5. Avatar for KNDSK 125. KNDSK Lv 1 1 pt. 9,021
  6. Avatar for ManVsYard 126. ManVsYard Lv 1 1 pt. 9,020
  7. Avatar for abiogenesis 127. abiogenesis Lv 1 1 pt. 9,019
  8. Avatar for parsnip 128. parsnip Lv 1 1 pt. 9,014
  9. Avatar for Thebatman012 129. Thebatman012 Lv 1 1 pt. 9,012
  10. Avatar for fishercat 130. fishercat Lv 1 1 pt. 9,011

Comments