Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,990
  2. Avatar for ricg test group 22. ricg test group 1 pt. 0
  1. Avatar for poiuyqwert 161. poiuyqwert Lv 1 1 pt. 8,793
  2. Avatar for 01010011111 162. 01010011111 Lv 1 1 pt. 8,772
  3. Avatar for Alisa Southerncross 163. Alisa Southerncross Lv 1 1 pt. 8,769
  4. Avatar for cnhrcolemam 164. cnhrcolemam Lv 1 1 pt. 8,764
  5. Avatar for heyubob 165. heyubob Lv 1 1 pt. 8,759
  6. Avatar for Kedath 166. Kedath Lv 1 1 pt. 8,756
  7. Avatar for dropsheep 167. dropsheep Lv 1 1 pt. 8,743
  8. Avatar for larry25427 168. larry25427 Lv 1 1 pt. 8,742
  9. Avatar for frezae 169. frezae Lv 1 1 pt. 8,738
  10. Avatar for HorribleIgor 170. HorribleIgor Lv 1 1 pt. 8,733

Comments