Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,990
  2. Avatar for ricg test group 22. ricg test group 1 pt. 0
  1. Avatar for crodr021 181. crodr021 Lv 1 1 pt. 8,233
  2. Avatar for bendbob 182. bendbob Lv 1 1 pt. 8,199
  3. Avatar for zkm 183. zkm Lv 1 1 pt. 7,990
  4. Avatar for aspadistra 184. aspadistra Lv 1 1 pt. 7,990
  5. Avatar for CharlieFortsConscience 185. CharlieFortsConscience Lv 1 1 pt. 7,884
  6. Avatar for RicGray 186. RicGray Lv 1 1 pt. 0
  7. Avatar for Jlove 187. Jlove Lv 1 1 pt. 0
  8. Avatar for Mike Cassidy 188. Mike Cassidy Lv 1 1 pt. 0
  9. Avatar for Deleted player 189. Deleted player pts. 0
  10. Avatar for Vera Van de Casteele 190. Vera Van de Casteele Lv 1 1 pt. 0

Comments