Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,990
  2. Avatar for ricg test group 22. ricg test group 1 pt. 0
  1. Avatar for hpaege 11. hpaege Lv 1 77 pts. 9,679
  2. Avatar for Galaxie 12. Galaxie Lv 1 75 pts. 9,672
  3. Avatar for smilingone 13. smilingone Lv 1 73 pts. 9,672
  4. Avatar for KarenCH 14. KarenCH Lv 1 71 pts. 9,663
  5. Avatar for mirp 15. mirp Lv 1 69 pts. 9,640
  6. Avatar for D001x_ErlandStevens 16. D001x_ErlandStevens Lv 1 67 pts. 9,634
  7. Avatar for crpainter 17. crpainter Lv 1 66 pts. 9,631
  8. Avatar for Idiotboy 18. Idiotboy Lv 1 64 pts. 9,621
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 62 pts. 9,621
  10. Avatar for smholst 20. smholst Lv 1 60 pts. 9,618

Comments