Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,990
  2. Avatar for ricg test group 22. ricg test group 1 pt. 0
  1. Avatar for Norrjane 51. Norrjane Lv 1 23 pts. 9,425
  2. Avatar for Graham MF 52. Graham MF Lv 1 22 pts. 9,413
  3. Avatar for dbuske 53. dbuske Lv 1 22 pts. 9,407
  4. Avatar for weitzen 54. weitzen Lv 1 21 pts. 9,406
  5. Avatar for Origami314 55. Origami314 Lv 1 20 pts. 9,401
  6. Avatar for tallguy-13088 56. tallguy-13088 Lv 1 19 pts. 9,390
  7. Avatar for YeshuaLives 57. YeshuaLives Lv 1 19 pts. 9,386
  8. Avatar for freethought78 58. freethought78 Lv 1 18 pts. 9,385
  9. Avatar for ecali 59. ecali Lv 1 17 pts. 9,383
  10. Avatar for Deleted player 60. Deleted player pts. 9,381

Comments