Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for DSN @ Home 21. DSN @ Home 1 pt. 7,990
  2. Avatar for ricg test group 22. ricg test group 1 pt. 0
  1. Avatar for alwen 61. alwen Lv 1 16 pts. 9,375
  2. Avatar for Vinara 62. Vinara Lv 1 16 pts. 9,354
  3. Avatar for Skippysk8s 63. Skippysk8s Lv 1 15 pts. 9,350
  4. Avatar for joremen 64. joremen Lv 1 15 pts. 9,349
  5. Avatar for Glen B 65. Glen B Lv 1 14 pts. 9,347
  6. Avatar for WBarme1234 66. WBarme1234 Lv 1 13 pts. 9,343
  7. Avatar for stomjoh 67. stomjoh Lv 1 13 pts. 9,339
  8. Avatar for actiasluna 68. actiasluna Lv 1 13 pts. 9,338
  9. Avatar for Crossed Sticks 69. Crossed Sticks Lv 1 12 pts. 9,330
  10. Avatar for isaksson 70. isaksson Lv 1 12 pts. 9,327

Comments