Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Beta Folders 100 pts. 9,856
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 9,727
  3. Avatar for Contenders 3. Contenders 61 pts. 9,725
  4. Avatar for Go Science 4. Go Science 47 pts. 9,702
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 9,672
  6. Avatar for D001x Med Chem MOOC 6. D001x Med Chem MOOC 26 pts. 9,634
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,625
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,621
  9. Avatar for Deleted group 9. Deleted group pts. 9,548
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,491

  1. Avatar for jebbiek 91. jebbiek Lv 1 5 pts. 9,206
  2. Avatar for mitarcher 92. mitarcher Lv 1 5 pts. 9,202
  3. Avatar for pandapharmd 93. pandapharmd Lv 1 5 pts. 9,170
  4. Avatar for Iron pet 94. Iron pet Lv 1 4 pts. 9,170
  5. Avatar for Superphosphate 95. Superphosphate Lv 1 4 pts. 9,166
  6. Avatar for SouperGenious 96. SouperGenious Lv 1 4 pts. 9,166
  7. Avatar for uihcv 97. uihcv Lv 1 4 pts. 9,158
  8. Avatar for Altercomp 98. Altercomp Lv 1 4 pts. 9,149
  9. Avatar for TastyMunchies 99. TastyMunchies Lv 1 3 pts. 9,147
  10. Avatar for tela 100. tela Lv 1 3 pts. 9,147

Comments