Placeholder image of a protein
Icon representing a puzzle

1238: Revisiting Puzzle 52: Bacteria Energy

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 24, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Beta Folders 100 pts. 9,856
  2. Avatar for Void Crushers 2. Void Crushers 79 pts. 9,727
  3. Avatar for Contenders 3. Contenders 61 pts. 9,725
  4. Avatar for Go Science 4. Go Science 47 pts. 9,702
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 35 pts. 9,672
  6. Avatar for D001x Med Chem MOOC 6. D001x Med Chem MOOC 26 pts. 9,634
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 9,625
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,621
  9. Avatar for Deleted group 9. Deleted group pts. 9,548
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,491

  1. Avatar for ViJay7019 41. ViJay7019 Lv 1 32 pts. 9,478
  2. Avatar for Anfinsen_slept_here 42. Anfinsen_slept_here Lv 1 31 pts. 9,476
  3. Avatar for Blipperman 43. Blipperman Lv 1 30 pts. 9,466
  4. Avatar for cbwest 44. cbwest Lv 1 29 pts. 9,466
  5. Avatar for hansvandenhof 45. hansvandenhof Lv 1 28 pts. 9,464
  6. Avatar for nicobul 46. nicobul Lv 1 27 pts. 9,463
  7. Avatar for deLaCeiba 47. deLaCeiba Lv 1 26 pts. 9,453
  8. Avatar for Marvelz 48. Marvelz Lv 1 25 pts. 9,450
  9. Avatar for fiendish_ghoul 49. fiendish_ghoul Lv 1 25 pts. 9,447
  10. Avatar for g_b 50. g_b Lv 1 24 pts. 9,439

Comments