Placeholder image of a protein
Icon representing a puzzle

1240b: Unsolved De-novo Freestyle 80: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 31, 2016
Expires
Max points
100
Description

Note: This puzzle is a repost of Puzzle 1240, which was closed early due to an error in sharing settings. In this puzzle, players should be able to correctly load in solutions from Puzzle 1237 and the original Puzzle 1240.



This is a follow-up puzzle for Puzzle 1237, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1237 and use them as a starting point here.



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 10,050
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,025
  3. Avatar for Russian team 13. Russian team 1 pt. 9,731
  4. Avatar for Deleted group 14. Deleted group pts. 9,667
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,107
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,376
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,089
  8. Avatar for BCC 18. BCC 1 pt. 4,998
  9. Avatar for Window Group 19. Window Group 1 pt. 0

  1. Avatar for Paulo Roque
    1. Paulo Roque Lv 1
    100 pts. 12,629
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 89 pts. 12,629
  3. Avatar for jeff101 3. jeff101 Lv 1 78 pts. 12,629
  4. Avatar for DodoBird 4. DodoBird Lv 1 69 pts. 12,618
  5. Avatar for mirp 5. mirp Lv 1 60 pts. 12,617
  6. Avatar for Galaxie 6. Galaxie Lv 1 53 pts. 12,606
  7. Avatar for Hollinas 7. Hollinas Lv 1 46 pts. 12,595
  8. Avatar for Anfinsen_slept_here 8. Anfinsen_slept_here Lv 1 40 pts. 12,593
  9. Avatar for Deleted player 9. Deleted player pts. 12,592
  10. Avatar for bendbob 10. bendbob Lv 1 29 pts. 12,592

Comments