Placeholder image of a protein
Icon representing a puzzle

1240b: Unsolved De-novo Freestyle 80: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 31, 2016
Expires
Max points
100
Description

Note: This puzzle is a repost of Puzzle 1240, which was closed early due to an error in sharing settings. In this puzzle, players should be able to correctly load in solutions from Puzzle 1237 and the original Puzzle 1240.



This is a follow-up puzzle for Puzzle 1237, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1237 and use them as a starting point here.



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 10,050
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,025
  3. Avatar for Russian team 13. Russian team 1 pt. 9,731
  4. Avatar for Deleted group 14. Deleted group pts. 9,667
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,107
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,376
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,089
  8. Avatar for BCC 18. BCC 1 pt. 4,998
  9. Avatar for Window Group 19. Window Group 1 pt. 0

  1. Avatar for ViJay7019 91. ViJay7019 Lv 1 5 pts. 9,509
  2. Avatar for ratqueen03 92. ratqueen03 Lv 1 5 pts. 9,509
  3. Avatar for ManVsYard 93. ManVsYard Lv 1 5 pts. 9,504
  4. Avatar for YeshuaLives 94. YeshuaLives Lv 1 5 pts. 9,468
  5. Avatar for zladko 95. zladko Lv 1 4 pts. 9,409
  6. Avatar for Squirrely 96. Squirrely Lv 1 4 pts. 9,407
  7. Avatar for Alistair69 97. Alistair69 Lv 1 4 pts. 9,398
  8. Avatar for froggs554 98. froggs554 Lv 1 4 pts. 9,367
  9. Avatar for abiogenesis 99. abiogenesis Lv 1 4 pts. 9,359
  10. Avatar for Ashrai 100. Ashrai Lv 1 3 pts. 9,330

Comments