Placeholder image of a protein
Icon representing a puzzle

1240b: Unsolved De-novo Freestyle 80: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 31, 2016
Expires
Max points
100
Description

Note: This puzzle is a repost of Puzzle 1240, which was closed early due to an error in sharing settings. In this puzzle, players should be able to correctly load in solutions from Puzzle 1237 and the original Puzzle 1240.



This is a follow-up puzzle for Puzzle 1237, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1237 and use them as a starting point here.



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for xkcd 11. xkcd 2 pts. 10,050
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 10,025
  3. Avatar for Russian team 13. Russian team 1 pt. 9,731
  4. Avatar for Deleted group 14. Deleted group pts. 9,667
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 9,107
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 8,376
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,089
  8. Avatar for BCC 18. BCC 1 pt. 4,998
  9. Avatar for Window Group 19. Window Group 1 pt. 0

  1. Avatar for crpainter 51. crpainter Lv 1 23 pts. 10,380
  2. Avatar for alwen 52. alwen Lv 1 23 pts. 10,352
  3. Avatar for smilingone 53. smilingone Lv 1 22 pts. 10,328
  4. Avatar for weitzen 54. weitzen Lv 1 21 pts. 10,301
  5. Avatar for Bletchley Park 55. Bletchley Park Lv 1 20 pts. 10,283
  6. Avatar for g_b 56. g_b Lv 1 20 pts. 10,281
  7. Avatar for WBarme1234 57. WBarme1234 Lv 1 19 pts. 10,274
  8. Avatar for jeff101 58. jeff101 Lv 1 18 pts. 10,220
  9. Avatar for heather-1 59. heather-1 Lv 1 18 pts. 10,218
  10. Avatar for Blipperman 60. Blipperman Lv 1 17 pts. 10,126

Comments