Placeholder image of a protein
Icon representing a puzzle

1240b: Unsolved De-novo Freestyle 80: Predicted Contacts

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction Predicted Contacts Predicted Contacts

Summary


Created
May 31, 2016
Expires
Max points
100
Description

Note: This puzzle is a repost of Puzzle 1240, which was closed early due to an error in sharing settings. In this puzzle, players should be able to correctly load in solutions from Puzzle 1237 and the original Puzzle 1240.



This is a follow-up puzzle for Puzzle 1237, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1237 and use them as a starting point here.



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for Go Science 100 pts. 12,629
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,606
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 12,405
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 12,298
  5. Avatar for Contenders 5. Contenders 29 pts. 12,099
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 12,073
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 11,725
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,201
  9. Avatar for Deleted group 9. Deleted group pts. 11,000
  10. Avatar for D001x Med Chem MOOC 10. D001x Med Chem MOOC 4 pts. 10,672

  1. Avatar for demeter900 141. demeter900 Lv 1 1 pt. 7,667
  2. Avatar for trefresher 142. trefresher Lv 1 1 pt. 7,618
  3. Avatar for ChrisScientist 143. ChrisScientist Lv 1 1 pt. 7,526
  4. Avatar for Merf 144. Merf Lv 1 1 pt. 7,510
  5. Avatar for scottwuzhear 145. scottwuzhear Lv 1 1 pt. 7,498
  6. Avatar for emelia24 146. emelia24 Lv 1 1 pt. 7,481
  7. Avatar for KNDSK 147. KNDSK Lv 1 1 pt. 7,407
  8. Avatar for cnhrcolemam 148. cnhrcolemam Lv 1 1 pt. 7,347
  9. Avatar for Inkedhands 149. Inkedhands Lv 1 1 pt. 7,341

Comments