Placeholder image of a protein
Icon representing a puzzle

1240b: Unsolved De-novo Freestyle 80: Predicted Contacts

Closed since almost 10 years ago

Intermediate Overall Prediction Predicted Contacts

Summary


Created
May 31, 2016
Expires
Max points
100
Description

Note: This puzzle is a repost of Puzzle 1240, which was closed early due to an error in sharing settings. In this puzzle, players should be able to correctly load in solutions from Puzzle 1237 and the original Puzzle 1240.



This is a follow-up puzzle for Puzzle 1237, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzle 1237 and use them as a starting point here.



Sequence:


GYSLVVRVVANDRSGLLRDITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDARRLHGS

Top groups


  1. Avatar for Go Science 100 pts. 12,629
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,606
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 12,405
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 12,298
  5. Avatar for Contenders 5. Contenders 29 pts. 12,099
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 12,073
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 11,725
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 11,201
  9. Avatar for Deleted group 9. Deleted group pts. 11,000
  10. Avatar for D001x Med Chem MOOC 10. D001x Med Chem MOOC 4 pts. 10,672

  1. Avatar for Deleted player 181. Deleted player pts. 0
  2. Avatar for TomekGK 182. TomekGK Lv 1 1 pt. 0
  3. Avatar for YGK 183. YGK Lv 1 1 pt. 0
  4. Avatar for vLime 184. vLime Lv 1 1 pt. 0
  5. Avatar for ZeroLeak7 185. ZeroLeak7 Lv 1 1 pt. 0
  6. Avatar for Hollinas 186. Hollinas Lv 1 1 pt. 0
  7. Avatar for lockert 187. lockert Lv 1 1 pt. 0
  8. Avatar for lamoille 188. lamoille Lv 1 1 pt. 0
  9. Avatar for zkm 189. zkm Lv 1 1 pt. 0
  10. Avatar for tela 190. tela Lv 1 1 pt. 0

Comments