Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0
  1. Avatar for pfirth 91. pfirth Lv 1 4 pts. 7,998
  2. Avatar for ecali 92. ecali Lv 1 4 pts. 7,976
  3. Avatar for YGK 93. YGK Lv 1 4 pts. 7,975
  4. Avatar for midnightsun-07 94. midnightsun-07 Lv 1 3 pts. 7,965
  5. Avatar for tomespen 95. tomespen Lv 1 3 pts. 7,949
  6. Avatar for ppp6 96. ppp6 Lv 1 3 pts. 7,947
  7. Avatar for alwen 97. alwen Lv 1 3 pts. 7,945
  8. Avatar for manu8170 98. manu8170 Lv 1 3 pts. 7,939
  9. Avatar for mitarcher 99. mitarcher Lv 1 3 pts. 7,936
  10. Avatar for Superphosphate 100. Superphosphate Lv 1 3 pts. 7,930

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.