Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0
  1. Avatar for dssb 111. dssb Lv 1 2 pts. 7,858
  2. Avatar for hada 112. hada Lv 1 1 pt. 7,847
  3. Avatar for BCAA 113. BCAA Lv 1 1 pt. 7,840
  4. Avatar for Graham MF 114. Graham MF Lv 1 1 pt. 7,835
  5. Avatar for KingLear 115. KingLear Lv 1 1 pt. 7,832
  6. Avatar for Deleted player 116. Deleted player pts. 7,818
  7. Avatar for NotJim99 117. NotJim99 Lv 1 1 pt. 7,791
  8. Avatar for Gagarin78 118. Gagarin78 Lv 1 1 pt. 7,780
  9. Avatar for abiogenesis 119. abiogenesis Lv 1 1 pt. 7,763
  10. Avatar for Inkedhands 120. Inkedhands Lv 1 1 pt. 7,751

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.