Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0
  1. Avatar for ManVsYard 121. ManVsYard Lv 1 1 pt. 7,750
  2. Avatar for uihcv 122. uihcv Lv 1 1 pt. 7,727
  3. Avatar for Bautho 123. Bautho Lv 1 1 pt. 7,660
  4. Avatar for brolly 124. brolly Lv 1 1 pt. 7,637
  5. Avatar for joaniegirl 125. joaniegirl Lv 1 1 pt. 7,615
  6. Avatar for Tac1 126. Tac1 Lv 1 1 pt. 7,612
  7. Avatar for NinguLilium 127. NinguLilium Lv 1 1 pt. 7,606
  8. Avatar for Punktchen 128. Punktchen Lv 1 1 pt. 7,596
  9. Avatar for Hollinas 129. Hollinas Lv 1 1 pt. 7,577
  10. Avatar for dropsheep 130. dropsheep Lv 1 1 pt. 7,548

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.