Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0

  1. Avatar for dahast.de 131. dahast.de Lv 1 1 pt. 7,547
  2. Avatar for jefferson20080808 132. jefferson20080808 Lv 1 1 pt. 7,534
  3. Avatar for mirjamvandelft 133. mirjamvandelft Lv 1 1 pt. 7,523
  4. Avatar for rinze 134. rinze Lv 1 1 pt. 7,507
  5. Avatar for jebbiek 135. jebbiek Lv 1 1 pt. 7,502
  6. Avatar for jermainiac 136. jermainiac Lv 1 1 pt. 7,500
  7. Avatar for placid.lion 137. placid.lion Lv 1 1 pt. 7,474
  8. Avatar for JaBBaTh3Hutt 138. JaBBaTh3Hutt Lv 1 1 pt. 7,450
  9. Avatar for Museka 139. Museka Lv 1 1 pt. 7,400
  10. Avatar for Wheeler22 140. Wheeler22 Lv 1 1 pt. 7,384

Comments


Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.