Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0
  1. Avatar for xolroc 141. xolroc Lv 1 1 pt. 7,376
  2. Avatar for poiuyqwert 142. poiuyqwert Lv 1 1 pt. 7,364
  3. Avatar for aaronevensen 143. aaronevensen Lv 1 1 pt. 7,329
  4. Avatar for SouperGenious 144. SouperGenious Lv 1 1 pt. 7,318
  5. Avatar for zakmiller 145. zakmiller Lv 1 1 pt. 7,296
  6. Avatar for lockert 146. lockert Lv 1 1 pt. 7,293
  7. Avatar for ChrisScientist 147. ChrisScientist Lv 1 1 pt. 7,254
  8. Avatar for martinf 148. martinf Lv 1 1 pt. 7,208
  9. Avatar for nemo7731 149. nemo7731 Lv 1 1 pt. 7,081
  10. Avatar for KNDSK 150. KNDSK Lv 1 1 pt. 7,054

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.