Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0
  1. Avatar for Alisa Southerncross 161. Alisa Southerncross Lv 1 1 pt. 6,410
  2. Avatar for Cerzax 162. Cerzax Lv 1 1 pt. 6,317
  3. Avatar for cnhrcolemam 163. cnhrcolemam Lv 1 1 pt. 6,313
  4. Avatar for cieplysdz 164. cieplysdz Lv 1 1 pt. 6,170
  5. Avatar for jeacom 165. jeacom Lv 1 1 pt. 6,089
  6. Avatar for bcd 166. bcd Lv 1 1 pt. 5,810
  7. Avatar for Lophty 167. Lophty Lv 1 1 pt. 5,701
  8. Avatar for proteina_orgasmo 168. proteina_orgasmo Lv 1 1 pt. 5,361
  9. Avatar for temandocorreo 169. temandocorreo Lv 1 1 pt. 5,050
  10. Avatar for Deleted player 170. Deleted player pts. 5,025

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.