Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0
  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 57 pts. 8,465
  2. Avatar for isaksson 22. isaksson Lv 1 55 pts. 8,465
  3. Avatar for Susume 23. Susume Lv 1 53 pts. 8,460
  4. Avatar for Timo van der Laan 24. Timo van der Laan Lv 1 52 pts. 8,451
  5. Avatar for grogar7 25. grogar7 Lv 1 50 pts. 8,447
  6. Avatar for johnmitch 26. johnmitch Lv 1 48 pts. 8,431
  7. Avatar for TastyMunchies 27. TastyMunchies Lv 1 47 pts. 8,429
  8. Avatar for Mike Lewis 28. Mike Lewis Lv 1 46 pts. 8,416
  9. Avatar for nicobul 29. nicobul Lv 1 44 pts. 8,415
  10. Avatar for Deleted player 30. Deleted player pts. 8,407

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.