Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0
  1. Avatar for ViJay7019 51. ViJay7019 Lv 1 21 pts. 8,273
  2. Avatar for christioanchauvin 52. christioanchauvin Lv 1 20 pts. 8,254
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 19 pts. 8,253
  4. Avatar for phi16 54. phi16 Lv 1 19 pts. 8,253
  5. Avatar for Vincenzo Brancaccio 55. Vincenzo Brancaccio Lv 1 18 pts. 8,245
  6. Avatar for stomjoh 56. stomjoh Lv 1 17 pts. 8,245
  7. Avatar for Vinara 57. Vinara Lv 1 17 pts. 8,237
  8. Avatar for jobo0502 58. jobo0502 Lv 1 16 pts. 8,225
  9. Avatar for Merf 59. Merf Lv 1 15 pts. 8,211
  10. Avatar for scottwuzhear 60. scottwuzhear Lv 1 15 pts. 8,197

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.