Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0

  1. Avatar for altejoh 61. altejoh Lv 1 14 pts. 8,174
  2. Avatar for jamiexq 62. jamiexq Lv 1 14 pts. 8,167
  3. Avatar for drumpeter18yrs9yrs 63. drumpeter18yrs9yrs Lv 1 13 pts. 8,161
  4. Avatar for Satina 64. Satina Lv 1 13 pts. 8,160
  5. Avatar for Glen B 65. Glen B Lv 1 12 pts. 8,158
  6. Avatar for tallguy-13088 66. tallguy-13088 Lv 1 12 pts. 8,153
  7. Avatar for smholst 67. smholst Lv 1 11 pts. 8,145
  8. Avatar for weitzen 68. weitzen Lv 1 11 pts. 8,143
  9. Avatar for joremen 69. joremen Lv 1 10 pts. 8,132
  10. Avatar for diamonddays 70. diamonddays Lv 1 10 pts. 8,131

Comments


Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.