Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,083
  2. Avatar for xkcd 12. xkcd 1 pt. 8,061
  3. Avatar for Team China 13. Team China 1 pt. 8,026
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 7,904
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 7,840
  6. Avatar for KaosKorp 16. KaosKorp 1 pt. 7,450
  7. Avatar for TheBirds 17. TheBirds 1 pt. 6,678
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 3,945
  9. Avatar for BCC 19. BCC 1 pt. 0
  1. Avatar for tarimo 71. tarimo Lv 1 9 pts. 8,129
  2. Avatar for WBarme1234 72. WBarme1234 Lv 1 9 pts. 8,122
  3. Avatar for SKSbell 73. SKSbell Lv 1 9 pts. 8,115
  4. Avatar for Fat Tony 74. Fat Tony Lv 1 8 pts. 8,111
  5. Avatar for pmthomson90 75. pmthomson90 Lv 1 8 pts. 8,103
  6. Avatar for Tehnologik1 76. Tehnologik1 Lv 1 8 pts. 8,086
  7. Avatar for kitek314_pl 77. kitek314_pl Lv 1 7 pts. 8,083
  8. Avatar for ratqueen03 78. ratqueen03 Lv 1 7 pts. 8,081
  9. Avatar for froggs554 79. froggs554 Lv 1 7 pts. 8,077
  10. Avatar for YeshuaLives 80. YeshuaLives Lv 1 6 pts. 8,075

Comments

Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.