Placeholder image of a protein
Icon representing a puzzle

1243: Unsolved De-novo Freestyle 81

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
June 07, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ISVRTVNSSSSMINPMATPATGAFNGTPASIKERVLPHTLPIDVDPFDSMASDTTRMVYGNTSSGGIIGSSALSAKAP

Top groups


  1. Avatar for Go Science 100 pts. 8,683
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 8,676
  3. Avatar for Contenders 3. Contenders 56 pts. 8,660
  4. Avatar for Beta Folders 4. Beta Folders 41 pts. 8,626
  5. Avatar for D001x Med Chem MOOC 5. D001x Med Chem MOOC 29 pts. 8,610
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,590
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,480
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,451
  9. Avatar for Deleted group 9. Deleted group pts. 8,161
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 4 pts. 8,103

  1. Avatar for Cerzax 162. Cerzax Lv 1 1 pt. 6,317
  2. Avatar for cnhrcolemam 163. cnhrcolemam Lv 1 1 pt. 6,313
  3. Avatar for cieplysdz 164. cieplysdz Lv 1 1 pt. 6,170
  4. Avatar for jeacom 165. jeacom Lv 1 1 pt. 6,089
  5. Avatar for bcd 166. bcd Lv 1 1 pt. 5,810
  6. Avatar for Lophty 167. Lophty Lv 1 1 pt. 5,701
  7. Avatar for proteina_orgasmo 168. proteina_orgasmo Lv 1 1 pt. 5,361
  8. Avatar for temandocorreo 169. temandocorreo Lv 1 1 pt. 5,050
  9. Avatar for Deleted player 170. Deleted player pts. 5,025

Comments


Mike Lewis Lv 1

Is the Rama map not available on this puzzle?

It's not visible on Original interface and greyed out on Selection, but a team member is using it. He is using devprev I am using main.