Placeholder image of a protein
Icon representing a puzzle

1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for xkcd 11. xkcd 1 pt. 8,591
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,498
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,484
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 6,655
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 6,400
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 0
  7. Avatar for Advanced Protein Science 2 - 2016 17. Advanced Protein Science 2 - 2016 1 pt. 0
  1. Avatar for Skippysk8s
    1. Skippysk8s Lv 1
    100 pts. 9,880
  2. Avatar for frood66 2. frood66 Lv 1 98 pts. 9,871
  3. Avatar for fiendish_ghoul 3. fiendish_ghoul Lv 1 95 pts. 9,843
  4. Avatar for LociOiling 4. LociOiling Lv 1 93 pts. 9,831
  5. Avatar for dembones 5. dembones Lv 1 91 pts. 9,830
  6. Avatar for pauldunn 6. pauldunn Lv 1 88 pts. 9,826
  7. Avatar for mirp 7. mirp Lv 1 86 pts. 9,816
  8. Avatar for bertro 8. bertro Lv 1 84 pts. 9,810
  9. Avatar for Timo van der Laan 9. Timo van der Laan Lv 1 81 pts. 9,803
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 79 pts. 9,803

Comments