1244: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 10 years ago

Summary

• Created: June 08, 2016
• Expires: June 15, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

• 1. Gargleblasters 100 pts. 9,909
• 2. Beta Folders 73 pts. 9,871
• 3. Contenders 52 pts. 9,830
• 4. Go Science 36 pts. 9,826
• 5. Void Crushers 24 pts. 9,803
• 6. L'Alliance Francophone 16 pts. 9,783
• 7. Anthropic Dreams 10 pts. 9,771
• 8. Italiani Al Lavoro 6 pts. 9,567
• 9. D001x Med Chem MOOC 4 pts. 9,533
• 10. Deleted group pts. 9,286

Top evolvers

• 1. Skippysk8s 100 pts. 9,909
• 2. Mike Lewis 88 pts. 9,907
• 3. Fat Tony 76 pts. 9,906
• 4. frood66 66 pts. 9,896
• 5. ManVsYard 57 pts. 9,895
• 6. Blipperman 49 pts. 9,895
• 7. Norrjane 42 pts. 9,894
• 8. Ashrai 36 pts. 9,887
• 9. smilingone 30 pts. 9,871
• 10. actiasluna 25 pts. 9,857