Placeholder image of a protein
Icon representing a puzzle

1249: Electron Density Reconstruction 1

Closed since almost 10 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
June 20, 2016
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRR

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 7,998
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 7,998
  3. Avatar for freefolder 13. freefolder 1 pt. 7,692
  4. Avatar for Team Mexico 14. Team Mexico 1 pt. 6,309
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 0
  6. Avatar for Window Group 16. Window Group 1 pt. 0

  1. Avatar for fryguy 41. fryguy Lv 1 27 pts. 9,299
  2. Avatar for YeshuaLives 42. YeshuaLives Lv 1 26 pts. 9,239
  3. Avatar for tallguy-13088 43. tallguy-13088 Lv 1 25 pts. 9,228
  4. Avatar for Deleted player 44. Deleted player pts. 9,163
  5. Avatar for dbuske 45. dbuske Lv 1 23 pts. 9,154
  6. Avatar for deLaCeiba 46. deLaCeiba Lv 1 22 pts. 9,104
  7. Avatar for Squirrely 47. Squirrely Lv 1 21 pts. 9,099
  8. Avatar for phi16 48. phi16 Lv 1 21 pts. 9,073
  9. Avatar for ppp6 49. ppp6 Lv 1 20 pts. 9,045
  10. Avatar for Bruno Kestemont 50. Bruno Kestemont Lv 1 19 pts. 9,014

Comments


TomTaylor Lv 1

Clicked to open puzzle 1249 and foldit crashes within seconds. Have tried five times now. Running Windows 10.

Susume Lv 1

Have crashed 4 out of 4 times when opening puzzle. In a new client, once with network timeouts enabled and twice with disabled. Also when switching to 1249 from another puzzle. Puzzle screen comes up, protein is visible, scoreboard loads, then screen goes gray and crash message from Windows.

Win 7 64, 20160609-a37c535a0d-win_x86-devprev

bkoep Staff Lv 1

This seems to be a problem with the "electron_density_panel/threshold" setting in the options.txt file. We're working on a fix for this bug; in the mean time, players can try deleting their options.txt file before starting a new client.

Susume Lv 1

Or if you are comfortable editing your options.txt file, set
"electron_density_panel/threshold" : "0.50"

TomTaylor Lv 1

After comparing the old and newly created options.txt files made the following setting change.

"electron_density_panel/threshold" : "0.500000"

Appears to be working fine now.

gitwut Lv 1

If the structure is known (or almost known) why is the density cloud image so poor? I've played with all the settings and I can't seem to make out a single structure from it.

I'm not a fan of either the Electron Density or Contact Map puzzles, but if the structure is reasonably known, wouldn't a contact map puzzle have been a better choice for this puzzle?

bkoep Staff Lv 1

This density has the potential to look much clearer. When generating this map, we took some steps to limit model bias (a phenomenon in which a poor model can be used to make a deceitfully clear map), but this process also removes some genuine information from the density. Model bias is probably not a huge problem in this particular case, but we wanted to allow Foldit players the opportunity to meet the greater challenge. It is very likely we will repost this puzzle in the future with a refined density map.

In general, an electron density map will contain much more information than a contact map. A model that fits electron density data is much, much more reliable than a model that fits contact data.