Placeholder image of a protein
Icon representing a puzzle

1249: Electron Density Reconstruction 1

Closed since over 9 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
June 20, 2016
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 13,648
  2. Avatar for Go Science 2. Go Science 71 pts. 13,647
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 13,625
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,446
  5. Avatar for Contenders 5. Contenders 22 pts. 10,133
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 9,960
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,853
  8. Avatar for xkcd 8. xkcd 5 pts. 9,299
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 3 pts. 9,104
  10. Avatar for Deleted group 10. Deleted group pts. 8,572

  1. Avatar for jflat06 151. jflat06 Lv 1 1 pt. 0
  2. Avatar for apepenrosa 152. apepenrosa Lv 1 1 pt. 0
  3. Avatar for crpainter 153. crpainter Lv 1 1 pt. 0
  4. Avatar for paulgene89 154. paulgene89 Lv 1 1 pt. 0
  5. Avatar for Hector1 155. Hector1 Lv 1 1 pt. 0
  6. Avatar for Mark- 156. Mark- Lv 1 1 pt. 0
  7. Avatar for poiuyqwert 157. poiuyqwert Lv 1 1 pt. 0
  8. Avatar for Ellis Shih 158. Ellis Shih Lv 1 1 pt. 0
  9. Avatar for andrewxc 159. andrewxc Lv 1 1 pt. 0
  10. Avatar for KarenCH 160. KarenCH Lv 1 1 pt. 0

Comments


retiredmichael Lv 1

args passed:
'C:\Foldit\foldit3\Foldit\Foldit.exe'
starting the init thread!..
boinc base url: https://fold.it
checking updates…
binary
local: 'cc851479fcf63a3ea048c70a4d550955'
remote: 'cc851479fcf63a3ea048c70a4d550955'
database
local: '4aa3799f5de6b1475e948fb77682d90f'
remote: '4aa3799f5de6b1475e948fb77682d90f'
resources
local: 'f3f5689675a05a73fb3d5d1f6e8950e6'
remote: 'f3f5689675a05a73fb3d5d1f6e8950e6'
cleaning up old components:
binary 00000000000000000000000000000000
binary cc851479fcf63a3ea048c70a4d550955
database 4aa3799f5de6b1475e948fb77682d90f
resources 00000000000000000000000000000000
resources f3f5689675a05a73fb3d5d1f6e8950e6
CRASH: 455069
SoundTheme::load: cmp-resources-f3f5689675a05a73fb3d5d1f6e8950e6\resources\sounds/organic_01
loading: cmp-resources-f3f5689675a05a73fb3d5d1f6e8950e6\resources\sounds/organic_01/rotamer_land_00.ogg
loading: cmp-resources-f3f5689675a05a73fb3d5d1f6e8950e6\resources\sounds/organic_01/rotamer_land_01.ogg
loading: cmp-resources-f3f5689675a05a73fb3d5d1f6e8950e6\resources\sounds/organic_01/rotamer_land_02.ogg
loading: cmp-resources-f3f5689675a05a73fb3d5d1f6e8950e6\resources\sounds/organic_01/rotamer_land_03.ogg
loading: cmp-resources-f3f5689675a05a73fb3d5d1f6e8950e6\resources\sounds/organic_01/rotamer_land_04.ogg
loading: cmp-resources-f3f5689675a05a73fb3d5d1f6e8950e6\resources\sounds/organic_01/rotamer_land_05.ogg
SVM classifier successfully loaded
Feature list successfully loaded
Valid classifier feature list
Duplicate hotkey Ctrl+Shift+E (Show constraints, Show ligand constraints)
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue LEU:CtermProteinFull 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue GLU:CtermProteinFull 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue LYS:CtermProteinFull 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue ARG:CtermProteinFull 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue ASP:CtermProteinFull 21
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue LEU:CtermProteinFull 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue THR:CtermProteinFull 16
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue VAL:CtermProteinFull 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue ARG:CtermProteinFull 17
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue LYS:CtermProteinFull 16
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue ASN:CtermProteinFull 16
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue GLU:CtermProteinFull 16
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue ASP:CtermProteinFull 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue MET:CtermProteinFull 13
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue ARG:CtermProteinFull 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue GLU:CtermProteinFull 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue ASN:CtermProteinFull 12
core.conformation.Conformation: [ WARNING ] missing heavyatom: OXT on residue GLU:CtermProteinFull 12
buildid: 20160609-a37c535a0d-win_x86
about to create view_options_button_
Duplicate hotkey Shift+L (Show outlines, )
setting side chain mode to: 0 Don't Show (Fast)
Playing: sounds/organic_01/splashscreen.ogg
Converting any old-style quicksaves and autosaves…
Reading in vall_torsions file: cmp-database-4aa3799f5de6b1475e948fb77682d90f\database\sampling/rna/1jj2.torsions
Lines read from vall_torsions file: 2754

Skippysk8s Lv 1

known klutz about manipulating software. but it crashes the minute I try to do anything. not workable for me. Windows 7 system