Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,455
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,308
  3. Avatar for Deleted group 13. Deleted group pts. 8,234
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 7,609
  5. Avatar for freefolder 15. freefolder 1 pt. 7,380
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0

  1. Avatar for abiogenesis 101. abiogenesis Lv 1 2 pts. 8,271
  2. Avatar for savinovalex 102. savinovalex Lv 1 2 pts. 8,264
  3. Avatar for ratqueen03 103. ratqueen03 Lv 1 2 pts. 8,262
  4. Avatar for tarimo 104. tarimo Lv 1 1 pt. 8,257
  5. Avatar for Cerzax 105. Cerzax Lv 1 1 pt. 8,234
  6. Avatar for Amphimixus 106. Amphimixus Lv 1 1 pt. 8,234
  7. Avatar for ManVsYard 107. ManVsYard Lv 1 1 pt. 8,230
  8. Avatar for Arne Heessels 108. Arne Heessels Lv 1 1 pt. 8,207
  9. Avatar for Superphosphate 109. Superphosphate Lv 1 1 pt. 8,201
  10. Avatar for uihcv 110. uihcv Lv 1 1 pt. 8,200

Comments