Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,455
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,308
  3. Avatar for Deleted group 13. Deleted group pts. 8,234
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 7,609
  5. Avatar for freefolder 15. freefolder 1 pt. 7,380
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for xplocast1 141. xplocast1 Lv 1 1 pt. 7,460
  2. Avatar for demeter900 142. demeter900 Lv 1 1 pt. 7,446
  3. Avatar for Dempy 143. Dempy Lv 1 1 pt. 7,424
  4. Avatar for RaeRae61 144. RaeRae61 Lv 1 1 pt. 7,414
  5. Avatar for Altercomp 145. Altercomp Lv 1 1 pt. 7,380
  6. Avatar for jayaygee 146. jayaygee Lv 1 1 pt. 7,325
  7. Avatar for Wheeler22 147. Wheeler22 Lv 1 1 pt. 7,318
  8. Avatar for Tac1 148. Tac1 Lv 1 1 pt. 7,260
  9. Avatar for HarryBalboa 149. HarryBalboa Lv 1 1 pt. 7,031
  10. Avatar for pBadMuthaF 150. pBadMuthaF Lv 1 1 pt. 6,683

Comments