Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,455
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,308
  3. Avatar for Deleted group 13. Deleted group pts. 8,234
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 7,609
  5. Avatar for freefolder 15. freefolder 1 pt. 7,380
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0

  1. Avatar for jul059 151. jul059 Lv 1 1 pt. 6,564
  2. Avatar for firejuggler 152. firejuggler Lv 1 1 pt. 6,518
  3. Avatar for emtonsti 153. emtonsti Lv 1 1 pt. 6,468
  4. Avatar for Museka 154. Museka Lv 1 1 pt. 6,467
  5. Avatar for Blitzghost 155. Blitzghost Lv 1 1 pt. 6,373
  6. Avatar for DScott 156. DScott Lv 1 1 pt. 6,202
  7. Avatar for fuzzykitty3 157. fuzzykitty3 Lv 1 1 pt. 5,270
  8. Avatar for matis666 158. matis666 Lv 1 1 pt. 4,793
  9. Avatar for ivalnic 159. ivalnic Lv 1 1 pt. 4,735
  10. Avatar for 01010011111 160. 01010011111 Lv 1 1 pt. 4,654

Comments