Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,455
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,308
  3. Avatar for Deleted group 13. Deleted group pts. 8,234
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 7,609
  5. Avatar for freefolder 15. freefolder 1 pt. 7,380
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for Tehnologik1 61. Tehnologik1 Lv 1 12 pts. 8,625
  2. Avatar for Vinara 62. Vinara Lv 1 12 pts. 8,617
  3. Avatar for phi16 63. phi16 Lv 1 11 pts. 8,606
  4. Avatar for jdormaar 64. jdormaar Lv 1 11 pts. 8,603
  5. Avatar for alwen 65. alwen Lv 1 10 pts. 8,599
  6. Avatar for bendbob 66. bendbob Lv 1 10 pts. 8,584
  7. Avatar for georg137 67. georg137 Lv 1 9 pts. 8,581
  8. Avatar for justjustin 68. justjustin Lv 1 9 pts. 8,581
  9. Avatar for alcor29 69. alcor29 Lv 1 8 pts. 8,578
  10. Avatar for fishercat 70. fishercat Lv 1 8 pts. 8,567

Comments