Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,455
  2. Avatar for It's over 9000! 12. It's over 9000! 1 pt. 8,308
  3. Avatar for Deleted group 13. Deleted group pts. 8,234
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 7,609
  5. Avatar for freefolder 15. freefolder 1 pt. 7,380
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for snakeguy 81. snakeguy Lv 1 5 pts. 8,504
  2. Avatar for drumpeter18yrs9yrs 82. drumpeter18yrs9yrs Lv 1 5 pts. 8,488
  3. Avatar for fryguy 83. fryguy Lv 1 4 pts. 8,482
  4. Avatar for pfirth 84. pfirth Lv 1 4 pts. 8,460
  5. Avatar for froggs554 85. froggs554 Lv 1 4 pts. 8,455
  6. Avatar for aendgraend 86. aendgraend Lv 1 4 pts. 8,455
  7. Avatar for Bautho 87. Bautho Lv 1 4 pts. 8,438
  8. Avatar for mitarcher 88. mitarcher Lv 1 3 pts. 8,436
  9. Avatar for hansvandenhof 89. hansvandenhof Lv 1 3 pts. 8,435
  10. Avatar for andrewxc 90. andrewxc Lv 1 3 pts. 8,426

Comments