Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since over 9 years ago

Intermediate Overall Prediction

Summary

Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,087
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,025
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,025
  4. Avatar for Go Science 4. Go Science 33 pts. 9,021
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,015
  6. Avatar for Contenders 6. Contenders 14 pts. 8,943
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 8,891
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 5 pts. 8,670
  9. Avatar for Deleted group 9. Deleted group pts. 8,488
  10. Avatar for xkcd 10. xkcd 2 pts. 8,482
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,087
  2. Avatar for lamoille 2. lamoille Lv 1 87 pts. 9,068
  3. Avatar for phi16 3. phi16 Lv 1 75 pts. 9,067
  4. Avatar for alwen 4. alwen Lv 1 64 pts. 9,054
  5. Avatar for gdnskye 5. gdnskye Lv 1 55 pts. 9,052
  6. Avatar for Blipperman 6. Blipperman Lv 1 47 pts. 9,025
  7. Avatar for actiasluna 7. actiasluna Lv 1 40 pts. 9,022
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 33 pts. 9,021
  9. Avatar for Paulo Roque 9. Paulo Roque Lv 1 28 pts. 9,021
  10. Avatar for tokens 10. tokens Lv 1 23 pts. 9,021

Comments