Placeholder image of a protein
Icon representing a puzzle

1252: Unsolved De-novo Freestyle 82

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
June 26, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MAASSRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRDMPRT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,087
  2. Avatar for Void Crushers 2. Void Crushers 71 pts. 9,025
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,025
  4. Avatar for Go Science 4. Go Science 33 pts. 9,021
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,015
  6. Avatar for Contenders 6. Contenders 14 pts. 8,943
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 8,891
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 5 pts. 8,670
  9. Avatar for Deleted group 9. Deleted group pts. 8,488
  10. Avatar for xkcd 10. xkcd 2 pts. 8,482

  1. Avatar for SKSbell 91. SKSbell Lv 1 3 pts. 8,402
  2. Avatar for YeshuaLives 92. YeshuaLives Lv 1 3 pts. 8,399
  3. Avatar for Alistair69 93. Alistair69 Lv 1 3 pts. 8,395
  4. Avatar for Ashrai 94. Ashrai Lv 1 2 pts. 8,388
  5. Avatar for guineapig 95. guineapig Lv 1 2 pts. 8,385
  6. Avatar for harvardman 96. harvardman Lv 1 2 pts. 8,363
  7. Avatar for BCAA 97. BCAA Lv 1 2 pts. 8,308
  8. Avatar for eromana 98. eromana Lv 1 2 pts. 8,301
  9. Avatar for Deleted player 99. Deleted player pts. 8,299
  10. Avatar for ecali 100. ecali Lv 1 2 pts. 8,292

Comments